PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.E04232.1.p
Common NameEUGRSUZ_E04232
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 330aa    MW: 36040 Da    PI: 5.9671
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.E04232.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1062.1e-3349103155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       k+rlrWt+eLHe+Fv+av+qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  Eucgr.E04232.1.p  49 KQRLRWTNELHEQFVDAVAQLGGPDRATPKGVLRVMGVPGLTIYHVKSHLQKYRL 103
                       79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.53446106IPR017930Myb domain
SuperFamilySSF466893.05E-1848103IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.6E-3248104IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-2549104IPR006447Myb domain, plants
PfamPF002491.7E-951102IPR001005SANT/Myb domain
PfamPF143791.8E-23135181IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MYQQRSVPSS SLVRNNSFTE GQQLDCGADA MVPMNGGNSL SNNSNLASKQ RLRWTNELHE  60
QFVDAVAQLG GPDRATPKGV LRVMGVPGLT IYHVKSHLQK YRLAKYLPDS SSDGKNAEKK  120
DSADIASNTD GSSGMQITEA LKLQMEVQKR LHEQLEVQRQ LQLRIEAQGK YLKKIIEEQQ  180
RLSGVLTDGS GLGDDCLESD KKSDPATPAP TSECPLQEKA FEDHAPGKSH SIDESLSSHH  240
EPQTPDSGCH VRPIAESPEG EKQAKKQRLT EDTAYAAEEL FTPHPILDSG LNSYQQSHPA  300
FLTREQFDPS LGISIANGEQ PRKVSSGSL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00252DAPTransfer from AT2G01060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.E04232.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010059710.10.0PREDICTED: uncharacterized protein LOC104447696
TrEMBLA0A059CC280.0A0A059CC28_EUCGR; Uncharacterized protein
STRINGVIT_00s0475g00040.t011e-167(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM87532536
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.11e-104G2-like family protein